PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang04g17680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 271aa    MW: 29919.2 Da    PI: 6.5659
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang04g17680.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.61.9e-101443130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     +g W++eEde+l+++++++G g+W+++++ 
   Vang04g17680.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKL 43
                     678************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-14643IPR009057Homeodomain-like
SuperFamilySSF466892.15E-8743IPR009057Homeodomain-like
PROSITE profilePS512949.681957IPR017930Myb domain
PfamPF002496.1E-81443IPR001005SANT/Myb domain
CDDcd001671.63E-61742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAASNEVS VVEPPKQKPI  60
TCTTSMPMDR YPLEVSATSK ISSGGNNSSS TLDRFGTCHD NNSSMASSDM MGMGYFPFQH  120
LNYGPNMGLT TANPNNTPLC FIPGSTSSQM MSELNSTMLH SVFSTHVKPT AESATKTDNK  180
DANSSHVVPL QSEAEDIKWS EYLNNTPFYL GSTVQQHQTT HSLYSDEVKP ETAFIADESS  240
TSWHHSQHFQ PSDIYSKDLQ RFSVAFGQSL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495198.17e-84PREDICTED: transcription factor MYB86
TrEMBLA0A0B2Q3263e-96A0A0B2Q326_GLYSO; Transcription factor MYB86
STRINGGLYMA03G38660.19e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-26myb domain protein 86